Protein Info for Echvi_0312 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF21799: MurD-like_N" amino acids 2 to 90 (89 residues), 36.4 bits, see alignment E=1e-12 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 3 to 442 (440 residues), 392.2 bits, see alignment E=1.8e-121 PF21377: MurD_N" amino acids 3 to 72 (70 residues), 35.9 bits, see alignment E=1.3e-12 PF08245: Mur_ligase_M" amino acids 107 to 285 (179 residues), 92.6 bits, see alignment E=6.8e-30 PF02875: Mur_ligase_C" amino acids 308 to 421 (114 residues), 57.3 bits, see alignment E=6.2e-19

Best Hits

Swiss-Prot: 46% identical to MURD_GRAFK: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Gramella forsetii (strain KT0803)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 46% identity to cao:Celal_2213)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUB2 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Echvi_0312 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKRIAILGAGESGIGAALLAKVNGYEVFVSDGGSIKEHRKQQLEDAGVDFEEGGHDAERL
LGFPEMIKSPGIPYSHPVVKAAMEQDIPVIDELEFAYGFSRGRVIAITGTNGKTTTAMLT
YHLMKTGGLDVGLGGNVGQSWASQLVQGDHDWWVLEVSSFQIDGFRSLKPKVAVLTNITP
DHLDRYDYKMDHYVQSKLGLLKQMDEEDDFIYYREDQHTWQGMSQINVRPKIHEISLETI
GKDGGLFNGTEVKLNFRNHMISIPEREMAMKGNHNMLNVMCASTAALLAGISEEALKAGL
ADFKNAPHRMELVRELEGVTFINDSKGTNVDATVYALSTFKEPLIWIAGGVDKGNDYETL
MPVVKDHVKVLICLGKDNKKLKTAFEGVVPEILETQEMAAAVQWGLEKGAKGDVVLLSPA
CASFDLFKNYEDRGDQFKEAVKQLKLKAL