Protein Info for Echvi_0311 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Bacterial cell division membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 154 to 186 (33 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 268 to 294 (27 residues), see Phobius details amino acids 307 to 333 (27 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF01098: FTSW_RODA_SPOVE" amino acids 18 to 366 (349 residues), 242.9 bits, see alignment E=2.7e-76

Best Hits

KEGG orthology group: K03588, cell division protein FtsW (inferred from 65% identity to mtt:Ftrac_3292)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTI5 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Echvi_0311 Bacterial cell division membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTSVKTWIDKNLKGDPIIWGIVLVLSIISILVVYSATGSLAYRRMGGNTEAYLIKHSSLV
LLSLVVMWGAHRLPYKYYSKLSLMALWISVPLLAFTYMFGSNVNDANRWLTIPIINQAFQ
PSDLAKLALIAAVAGMLGKRQKNIQDFKKTFIPVMIWIGMICLLIGLANMSTAVMLLCTC
LLLMFIGRVPVKFLIAVCLIGFLALTSAIFLGQRGGTFFSRIENFMSEEDIPYQAQQSYM
AIATGGVAGKGPGNSEQRNSLPHPYSDFIYAIIIEEYGMVGGGVVLFLYLALLYRGMRVV
AISNRPFGGLLSAGLSFALVIQAMVNMAVAVGLGPITGQPLPLLSMGGTSLLFTGVSLGI
ILSVSRGDHEDGFAGEMNIGNKNAMQMAQ