Protein Info for Echvi_0309 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: UDP-N-acetylmuramate--alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details PF01225: Mur_ligase" amino acids 9 to 112 (104 residues), 45.5 bits, see alignment E=1.2e-15 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 9 to 455 (447 residues), 373.4 bits, see alignment E=9.2e-116 PF08245: Mur_ligase_M" amino acids 118 to 300 (183 residues), 83.2 bits, see alignment E=3.7e-27 PF02875: Mur_ligase_C" amino acids 323 to 430 (108 residues), 60.4 bits, see alignment E=4.9e-20

Best Hits

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 51% identity to sli:Slin_4753)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVC0 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Echvi_0309 UDP-N-acetylmuramate--alanine ligase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNWDKLHSVYFLGIGGIGMSAIARWFNHIGIPVSGYDKTPSPLTRKLEEEGMRITYEDTL
ETIPSAIRGDKEHVLIVWTPAIPKDSVQLNFFQQEGFDLKKRSEVLGMITATMYTVGVAG
THGKTTTSSMVAHMLKSAGKNIAAFLGGLTQNYESNLILHDEENEEQPIVVVEADEFDRS
FLRLHPNVAVVTSVDADHLDIYGDAQELTRNFEQYIDLLPEDGVLFIQKNALQKLNRNDF
GSLTLRQYGLGEGAVRAENIKAGIASFEFDYVSEEKILKGLILRVPGFHNVENALASVSI
ALHFGVSEEAIRKGLETFKGVKRRFEIKRQDEKGVFIDDYAHHPEEIRAFLKSVKAMYPE
QKLTAVFQPHLYTRTRDFADGFSEALSLADEVILLDIYPARELPIDGVNAAMLLEKISAP
QKSLHSKEDLLGYLDKQRPAVLVTLGAGDIDRLVEPINNLIAQWD