Protein Info for Echvi_0303 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Flavodoxin reductases (ferredoxin-NADPH reductases) family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 106 to 122 (17 residues), see Phobius details PF08022: FAD_binding_8" amino acids 6 to 84 (79 residues), 25.4 bits, see alignment E=2.6e-09 PF00970: FAD_binding_6" amino acids 7 to 100 (94 residues), 26.1 bits, see alignment E=1.9e-09 PF08030: NAD_binding_6" amino acids 106 to 152 (47 residues), 24.5 bits, see alignment 5.1e-09 PF00175: NAD_binding_1" amino acids 107 to 204 (98 residues), 68.5 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 52% identity to mtt:Ftrac_2837)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FRP9 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Echvi_0303 Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MANYRLKILEITPVTHDVNRYKVEKPRGYQFTPGQATEVSLLQAGWEAEKRPFTFTNLPS
DDHLEFIIKSYDDHEGVTKRLASLSVGDEVEIGDPWGTISFKGEGVFIAGGAGITPFISI
LRHLRKKNQVGKSILIFANKTNDDIILFEELKAILGHKFINIIAKQKDTAYDKGLVDQAY
LKSKISDFDQHFYVCGPPGFMKAVTSSLKTLGADPDTLVFEQ