Protein Info for Echvi_0300 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: gliding motility-associated ABC transporter ATP-binding subunit GldA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR03522: gliding motility-associated ABC transporter ATP-binding subunit GldA" amino acids 1 to 301 (301 residues), 436.4 bits, see alignment E=3e-135 PF00005: ABC_tran" amino acids 18 to 162 (145 residues), 102.3 bits, see alignment E=3.7e-33

Best Hits

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 49% identity to chu:CHU_1545)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV17 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Echvi_0300 gliding motility-associated ABC transporter ATP-binding subunit GldA (Echinicola vietnamensis KMM 6221, DSM 17526)
MSLEVKELSKYYGQQRALKEVSFTAEKGQVLGFLGPNGAGKSTTMKIAAGYLLPDGGDVL
VNGVSVMDHPQEVSKMIGYLPEHNPLYLEMYVREFLSFMAGLYQLKGKKAKARIDGVVEA
CGLGDEQHKKIGALSKGYRQRVGLAKALVHDPAVIILDEPTSGLDPNQLVDIRKLIKSIS
AEKTLVLSTHVMQEVEALCEKVVIIHQGNVVSQDLLANLKSDNSEMVLYLETQERLREEW
FAAMEGLGELHVLGDGYFQLKAVNPTILRKEIMELISEKSLSLLSLRQEERNLESIFRQL
TGTKE