Protein Info for Echvi_0297 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA polymerase III, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00663: DNA polymerase III, beta subunit" amino acids 1 to 369 (369 residues), 286.3 bits, see alignment E=1.7e-89 PF00712: DNA_pol3_beta" amino acids 1 to 120 (120 residues), 85.6 bits, see alignment E=4.4e-28 PF02767: DNA_pol3_beta_2" amino acids 130 to 243 (114 residues), 80.1 bits, see alignment E=2.5e-26 PF02768: DNA_pol3_beta_3" amino acids 246 to 367 (122 residues), 77.5 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 76% identity to mtt:Ftrac_1425)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU99 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Echvi_0297 DNA polymerase III, beta subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFIVSSSALLKQLSGINGVVTTNPVVPILENFLFEIKEGKLTITASDLQTSMMTEIDVE
AKEDGNIAVPARILMETLKNLPEQPVTFSIDHDTYSVEISSDNGRYKLAGENATDFPKIP
SVSNATAVDMSTDVLSSAINNTIFATSNDELRPAMTGVYVNLSNTNTTFVATDGHRLIRY
RRVDIAAPEAASIIVPRKALNLLKSTLPSENIPVTVEFNNSNAYFKFGNIQMICRLVDER
YPDYENVIPVDNENNMTIDRVEFLSSLRRIAIYANKTTHQVRLKLTGSELQISAEDLDFS
NEANERLSCEHDGEDIEIGFNAKFLVEMLNNIGSKQVTLKFSAPNRAGLIVPSDKGENED
ILMLVMPVMLNNYV