Protein Info for Echvi_0250 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein L22, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF00237: Ribosomal_L22" amino acids 5 to 110 (106 residues), 119.7 bits, see alignment E=2.9e-39 TIGR01044: ribosomal protein uL22" amino acids 6 to 110 (105 residues), 100.7 bits, see alignment E=2.5e-33

Best Hits

Swiss-Prot: 72% identical to RL22_FLAPJ: 50S ribosomal protein L22 (rplV) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K02890, large subunit ribosomal protein L22 (inferred from 71% identity to mtt:Ftrac_3037)

Predicted SEED Role

"LSU ribosomal protein L22p (L17e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV73 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Echvi_0250 ribosomal protein L22, bacterial type (Echinicola vietnamensis KMM 6221, DSM 17526)
MEAIARLNNVPTSPRKMRLVADLVRGQRVGNALSILKFTPNHGAAKLEKLLLSAIANWQA
KNPDEKLEEADLYVKTIQVDGGRMLKRLRPAPQGRAHRIRKRSNHVTLVVDAFNSEVTAD
EVETKENAN