Protein Info for Echvi_0244 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein L24, bacterial/organelle

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01079: ribosomal protein uL24
  • amino acids 11 to 112 (102 residues), 123.6 bits, E=2e-40
• PF00467: KOW
  • amino acids 15 to 46 (32 residues), 34.9 bits, E=9.4e-13
• PF17136: ribosomal_L24
  • amino acids 48 to 112 (65 residues), 102.7 bits, E=1e-33

Best Hits

Swiss-Prot: 68% identical to RL24_CYTH3: 50S ribosomal protein L24 (rplX) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02895, large subunit ribosomal protein L24 (inferred from 71% identity to mtt:Ftrac_3043)

MetaCyc: 52% identical to 50S ribosomal subunit protein L24 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L24p (L26e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See L0FRK1 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Echvi_0244 ribosomal protein L24, bacterial/organelle (Echinicola vietnamensis KMM 6221, DSM 17526)
MERKKNKQPKLHIKRGDTVKVLSGDDKGKSGKVLSVNLEKRRAIVEGLNMVTKHVKPTAA
NPQGGIEKKEAAIHVSNLMLIDPKTGEATRTGRKPGENGKLVRYSKKTGEVING