Protein Info for Echvi_0227 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein L17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR00059: ribosomal protein bL17" amino acids 7 to 117 (111 residues), 141.9 bits, see alignment E=5e-46 PF01196: Ribosomal_L17" amino acids 20 to 116 (97 residues), 128.9 bits, see alignment E=5.6e-42

Best Hits

Swiss-Prot: 58% identical to RL17_GRAFK: 50S ribosomal protein L17 (rplQ) from Gramella forsetii (strain KT0803)

KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 56% identity to mtt:Ftrac_3059)

Predicted SEED Role

"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTC2 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Echvi_0227 ribosomal protein L17 (Echinicola vietnamensis KMM 6221, DSM 17526)
MRHGKKFNHLGRKASHRKAMLSNMAASLILHKRISTTLAKAKELRKYVEPLVTRAKEDTT
HNRRIAFSYLQNKEAIKALFGEVIEKVASRPGGYTRIIKTGFRLGDNAEMCIIELVDFNE
LMLKEAKPEKKKTRRSRRGSGKSAEAADATTEAKAEGTEEASSEAKEEKAPKAKKKAAEP
KAKKEDKAADDKAADGDADSDKETKSE