Protein Info for Echvi_0206 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulators of sugar metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF08279: HTH_11" amino acids 7 to 48 (42 residues), 35.5 bits, see alignment 1.9e-12 PF08220: HTH_DeoR" amino acids 7 to 57 (51 residues), 58.3 bits, see alignment 1.3e-19 PF08280: HTH_Mga" amino acids 7 to 45 (39 residues), 24.1 bits, see alignment 7.8e-09 PF00455: DeoRC" amino acids 74 to 231 (158 residues), 157.9 bits, see alignment E=5.4e-50

Best Hits

Swiss-Prot: 39% identical to AGAR_ECO57: Putative aga operon transcriptional repressor (agaR) from Escherichia coli O157:H7

KEGG orthology group: K02081, DeoR family transcriptional regulator, aga operon transcriptional repressor (inferred from 76% identity to dfe:Dfer_1716)

Predicted SEED Role

"Transcriptional repressor of aga operon" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTA3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Echvi_0206 Transcriptional regulators of sugar metabolism (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKTAQRRSRILEVLDEHGQVNVSELSKALGVSEVTIRNDLANLERNKLLVRAHGGAFKT
NNMALPVTEKKKINLDLKRKIGKKAVSMIEENDSIILDSGTTTFEISNNLSKFERLTVIS
NALDIVNNLASYDNLDVMMPGGFLKEFSMSLVGPMAERNLKQLHCNKMFLGVDGIKADVG
VFTHYMEEAYLNQIMIDIAEEVIVVSDSTKFKKIGLAFIAGFNKVHKVITDDRIETEHVK
MLERNNVEVIIAG