Protein Info for Echvi_0201 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00518: alanine dehydrogenase" amino acids 1 to 370 (370 residues), 520.2 bits, see alignment E=1.4e-160 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 159 bits, see alignment E=1.2e-50 PF01262: AlaDh_PNT_C" amino acids 141 to 352 (212 residues), 298.2 bits, see alignment E=4.5e-93 PF02826: 2-Hacid_dh_C" amino acids 170 to 268 (99 residues), 31 bits, see alignment E=2.5e-11

Best Hits

Swiss-Prot: 58% identical to DHA_METMP: Alanine dehydrogenase (ald) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 79% identity to mtt:Ftrac_3618)

MetaCyc: 55% identical to alanine dehydrogenase subunit (Klebsiella aerogenes)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.1

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT99 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Echvi_0201 alanine dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MIIGIPKEIKNNENRVALTPAGAQELVKRGHTVYVQHTAGEGSGFPDHLYEEAGAKILPT
IEETYRIAEMIMKVKEPIEPEYDLVREDQLLFTYFHFASHEPLTNAMIKSKSVCLAYETV
EKAGGGLPLLVPMSEVAGRMATQKGANYLEKPLGGKGILMGGVPGTLPAKVLILGGGVVG
TQAAWMAAGMKADVTILDVSLPRMRYLSDVMPANVKTRMSNEYNIRELIKTADLIIGAVL
IPGAKAPHLITRDMLKEMQPGTVLVDVAVDQGGCIETCKPTTHQDPTFTIDGVLHYCVAN
MPGAVPYTSTIALTNATLPYAIQLADKGWKKASKENKELALGLNVVKGDVVYKAVAEAFD
LPFIAVEKHLVD