Protein Info for Echvi_0166 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 6 to 600 (595 residues), 722 bits, see alignment E=5.2e-221 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 9 to 458 (450 residues), 528.3 bits, see alignment E=1.8e-162 PF04851: ResIII" amino acids 18 to 177 (160 residues), 32.5 bits, see alignment E=2.9e-11 PF00270: DEAD" amino acids 21 to 182 (162 residues), 101.4 bits, see alignment E=1.7e-32 PF00271: Helicase_C" amino acids 220 to 326 (107 residues), 80.1 bits, see alignment E=4.9e-26 PF16124: RecQ_Zn_bind" amino acids 337 to 398 (62 residues), 61.1 bits, see alignment 5e-20 PF09382: RQC" amino acids 402 to 509 (108 residues), 103.6 bits, see alignment E=2e-33 PF00570: HRDC" amino acids 531 to 597 (67 residues), 62.9 bits, see alignment E=7.5e-21 PF21220: RecQ-1-like_HTH" amino acids 621 to 671 (51 residues), 87.6 bits, see alignment 1.7e-28

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 67% identity to mtt:Ftrac_3348)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTV4 at UniProt or InterPro

Protein Sequence (725 amino acids)

>Echvi_0166 ATP-dependent DNA helicase RecQ (Echinicola vietnamensis KMM 6221, DSM 17526)
MDIKIKENLKKIFGFNQFRGNQEAIVDNILQGNNTFVIMPTGAGKSLCYQLPAVTKEGTA
IVISPLIALMKNQVDQLNAFGINAHFLNSTLSKTETNKVKKEVLSGATKLLYVAPESLTK
EENVEFLKSAQLSFVAIDEAHCISEWGHDFRPEYRKIKSIIAQIGDALPIIALTATATPK
VQQDIQRNLNMEEADLFKSSFNRTNLFYEVRPKAKSDTKKHLIKYVKSQKGKSGIIYCLS
RKKVEEIAELLKVNGINAAPYHAGLESAMRIKNQDDFLNEEVDVVVATIAFGMGIDKPDV
RYVIHYDVPKSLEGYYQETGRAGRDGLEGHCLMFYKYEDIVKLEKFNKDKPVNERENAKV
LLQEMAAYAESSVCRRRVLLHYFGESLNEDCGFCDNCKKKRDAFDAKEDILTAIEAVKET
HQRFSLDHIVNVIRGEQNEYMESYNHDGLSVFGKGKEENERYWRSVIRQTMIHGLLEKDI
ENYGVIKLSKTSEDFLKNPHEITFTKDHDFDEMIENDEAEEIANTNKAYDEKLFELLKVE
RKKVAKSKGLPPYVIFQDPSLEEMATVYPTSREELAQVNGVGMGKVTKFGAPFLKLITNY
VEENDIITASDVVVKTAGTRSKVKISIIQQVDRKIDLDEIASNLNIEMSELLQEIEQIIY
SGTKLNINYYIHNIMDEEREDILHDYFMTAETDNIREALQELEDEDFGEEEIRVYRIKFI
SDHAN