Protein Info for Echvi_0158 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted phosphosugar isomerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 177 to 196 (20 residues), see Phobius details PF01380: SIS" amino acids 59 to 193 (135 residues), 33.3 bits, see alignment E=2e-12

Best Hits

Predicted SEED Role

"Galactosamine-6-phosphate isomerase (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUV1 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Echvi_0158 Predicted phosphosugar isomerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MIQTTYLTLDSEKAEELGAFHTAKEIAGQPELWQRVFRQLKNEQNAIHSFIKPILEKGNA
RIVLTGAGSSAFIGESAQGIVQQLTGVHTQAIATTDVVTHPELFFLEKVPTLLVSFARSG
NSPESVEAVRLADAHCNEIYHLIITCNPDGELAAYANDCGGNCLALVLPEGSNDNSLAMT
GSFTSMLLAILLVAGIDQLDQLKQQFEDAAETANHILRNSLHEFEAVAKSDFNRVIFLGS
GAMLGVARECHLKLQELTDGKVVCKHDSFLGFRHGPRAVANEESIVVYLFSRDPHVVRYE
TDLAKSIGEDKRKIRTISFAAENTDGYHSILDLPAVGTSEKAIFNVLPATMVGQLLGFYK
CLQLGLHPDNPSVSGAISRVVQGVTIYNKA