Protein Info for Echvi_0153 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted dehydrogenases and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 4 to 26 (23 residues), 17.8 bits, see alignment (E = 1.7e-07) PF01408: GFO_IDH_MocA" amino acids 61 to 185 (125 residues), 48.8 bits, see alignment E=1.1e-16 PF21252: Glyco_hydro_109_C" amino acids 195 to 452 (258 residues), 251.5 bits, see alignment E=8.7e-79

Best Hits

KEGG orthology group: None (inferred from 63% identity to phe:Phep_0775)

Predicted SEED Role

"Oxidoreductase, Gfo/Idh/MocA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUU6 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Echvi_0153 Predicted dehydrogenases and related proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MSNNRRDFLKLSGLAGMGLVGAGMSGFTQPQLDEVLRQSKRKNNQRFNMSGYGAPKLDTV
RAGFIGLGMRGPGHVERMSKITGVEIKAICDLVPEKVDKVKEMLKDSPHDPDTYSGSAYA
WKKMVDRDDLDIIFILTPWEWHVPMAVYAMEADKHVAIEVPAAKTLEECWELVETSERTR
KHCMMMENCCYDFFEMMTLNMARDGFFGDVIHGEGAYIHDLLGLNFKKEGGYEDMWRLKE
NAHRNGNLYATHGLGPICQVMDINRGDQMDYLTSLSSNDFMMQQHAQELAEEDDFFASYA
NMQFRGNMNTTMVKTKKGRSIMIQHDVTSPRPYSRIHLVSGTKGIARKWPKQGVATGHRW
FSDEQMQELEEKYTPEITKKVGEMAKKIGGHGGMDFMMTWRLVDCLRNGLPLDQDVYDAA
LWSAFSPLSEWSVANKATSIDVPDFTGGSWKTNKPVSITLEGGGNTGVRI