Protein Info for Echvi_0152 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 190 (186 residues), 218.6 bits, E=4.8e-69
• PF00117: GATase
  • amino acids 6 to 186 (181 residues), 145.7 bits, E=3.5e-46
• PF07722: Peptidase_C26
  • amino acids 57 to 169 (113 residues), 32.5 bits, E=2e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 199 to 509 (311 residues), 468.1 bits, E=1.4e-144
• PF02540: NAD_synthase
  • amino acids 204 to 290 (87 residues), 35.3 bits, E=1.7e-12
• PF03054: tRNA_Me_trans
  • amino acids 215 to 248 (34 residues), 22.8 bits, see alignment (E = 1.6e-08)
• PF00958: GMP_synt_C
  • amino acids 419 to 508 (90 residues), 146.5 bits, E=4.8e-47

Best Hits

Swiss-Prot: 76% identical to GUAA_CYTH3: GMP synthase [glutamine-hydrolyzing] (guaA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 76% identity to mtt:Ftrac_3641)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See L0FR77 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Echvi_0152 GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MAEQILILDFGSQYTQLIARRVRELDVYCEIHPYNNIPEITPDIKGVILSGSPCSVRDEG
SPDVDLEQFRGKLPLLGVCYGSQLLAQKYGGNVTPSEIREYGRANLNFIDKHNDLFHEVS
HGSQVWMSHGDTIKELPQGWEVISSTASVKVAAFKVPDEDTFGIQFHPEVTHSEEGKNVL
RNFVVQICGCSQDWTSDVFIDATIDELKQKLGDDKVVMGLSGGVDSSVAATLIHRAIGDN
LVCVFVDNGLLRKHEYEEVLDSYKHLGLNVIGVDAKQRFYDALAGKSDPEDKRKAIGNTF
IEVFDDEAHKIQGVKWLGQGTIYPDVIESVSVNGPSATIKSHHNVGGLPDFMKLKVVEPL
NTLFKDGVREVGRALQIPEIIIGRHPFPGPGLAIRVLGEVTPEKVSILQEVDHIFIQGLK
DDNLYDEVWQAGAILLPVQSVGVMGDERTYEQVVALRAVTSVDGMTADWVHLPYEFLGKI
SNEIINKVKGVNRVVYDISSKPPATIEWE