Protein Info for Echvi_0142 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Domain of Unknown Function (DUF1599).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF07659: DUF1599" amino acids 23 to 83 (61 residues), 100.5 bits, see alignment E=2.7e-33 amino acids 116 to 177 (62 residues), 102.5 bits, see alignment E=6.1e-34

Best Hits

KEGG orthology group: None (inferred from 71% identity to mtt:Ftrac_3718)

Predicted SEED Role

"FIG00651728: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR65 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Echvi_0142 Domain of Unknown Function (DUF1599). (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTQTVSEYNQVIALCKELFKKKTVDYGTAWRVLRLPSITDQIFIKAQRIRSIQEKGTQR
VQDPVQDEFIGIINYCLIALIQMGLENDERLELGYEELEPMYDKWVDATRGLLENKNHDY
GEAWRDMRVSSMTDLILMKLYRVKQIEDNSGKTLASEGVDANYQDMINYSIFCLIKLKEQ
ADV