Protein Info for Echvi_0141 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane-associated, metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details PF07291: MauE" amino acids 4 to 142 (139 residues), 73 bits, see alignment E=3e-24 PF07681: DoxX" amino acids 8 to 99 (92 residues), 26.8 bits, see alignment E=6.6e-10

Best Hits

KEGG orthology group: None (inferred from 49% identity to sli:Slin_2314)

Predicted SEED Role

"FIG00694335: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTS4 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Echvi_0141 Predicted membrane-associated, metal-dependent hydrolase (Echinicola vietnamensis KMM 6221, DSM 17526)
MFKKVILNLFRFLVGGLFIFSGLIKVNDPVGTSIKLEEYFEVFSNDIAGFFEVFKSFALE
LSVLLIVLEVVLGVMLLLNYKPKLTISLLSILILFFTFLTFYSAYFNKVTDCGCFGDAIK
LTPWQSFYKDIALVVMIGVLFVFRKDLPQNTSKLSAGLVIGSAVGCLVLSLLAIRNLPFI
DFRAYKEGVNITEAMQPSGALEYRYIMKKDGEEVVMDEYPSDESYEFVDMQLKNPEALPK
IADFGIWNDDGDFTEAMLQGNKLLILISSYEKMDQAKLGNLDELMDVEGVETVIITATAA
DEIETVMTAQDWEVPYYFGDATVLKTIIRSNPGVVLLKDGTVLKKYHVNNAPNIAEVQEN
FNH