Protein Info for Echvi_0125 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 4 to 120 (117 residues), 23.7 bits, E=6.7e-09
• PF02153: PDH_N
  • amino acids 18 to 163 (146 residues), 103.3 bits, E=1.4e-33
• PF20463: PDH_C
  • amino acids 170 to 269 (100 residues), 85.6 bits, E=4e-28

Best Hits

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 50% identity to zpr:ZPR_3525)

Predicted SEED Role

"Prephenate and/or arogenate dehydrogenase (unknown specificity) (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• L-tyrosine biosynthesis III (2/4 steps found)
• 4-hydroxy-3-prenylbenzoate biosynthesis (1/4 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)

KEGG Metabolic Maps

• Novobiocin biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

See L0FSZ8 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Echvi_0125 Prephenate dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQIHIIGLGLLGGSFSLGLKKALTGLSVSGFDLNKGHLQEALSLGIIDRVSETVPADTD
LVIVATPVDTISGIVSRLLDHIPPETLVVDFGSTKEHICSSVSGHAHRQNFLAAHPIAGT
EYAGPSAAFPDLLKGKIMILCETDKTGPDLCKKAYRAFEALEMQIRIMGPHEHDNQLAFV
SHLSHISSFMLGKTVLDKMEDDKHILNMAGSGFASTVRLAKSSPSMWTPIMKENKENILE
ALNGYIENLASFRDHLVNDQYEELSKNMKNANQIGQILNFKS