Protein Info for Echvi_0121 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR01357: 3-dehydroquinate synthase" amino acids 9 to 330 (322 residues), 331.5 bits, see alignment E=3.2e-103 PF13685: Fe-ADH_2" amino acids 10 to 156 (147 residues), 33.7 bits, see alignment E=5.3e-12 PF01761: DHQ_synthase" amino acids 53 to 164 (112 residues), 142.7 bits, see alignment E=5.9e-46 PF24621: DHQS_C" amino acids 166 to 306 (141 residues), 128.2 bits, see alignment E=3.7e-41

Best Hits

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 53% identity to lby:Lbys_1928)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTQ3 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Echvi_0121 3-dehydroquinate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MESIIFSTQIAPDLERFLKSKNFSKLGVITDSNTSQACYPLIREALPLHEHFAFEAGEVN
KNLDTCQKIWQWMTDCGFDRKSLIINLGGGVTGDMGGFCASTYKRGVKFINIPTTLLSQV
DASVGGKLGVDFNGFKNHIGVFNEPEAVIISAAFLSSLPLPELRSGYAEVLKHGLIRNEN
YFNSLKLQNWEDQRWTEIIEKSVYIKKDVVTKDPKEDGLRKILNFGHTVGHAVESFYLDT
ERHLLHGEAIAIGMIAEAYLSQKHIRLPKEELQSITTALLEVFGKVEIPKEDLDAIAQLC
FQDKKNDGKTINCSLLKKIGECDYNIAVSLDDIIDSLHFYNNQHS