Protein Info for Echvi_0101 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF14595: Thioredoxin_9" amino acids 38 to 166 (129 residues), 144.3 bits, see alignment E=1e-46

Best Hits

KEGG orthology group: None (inferred from 47% identity to psn:Pedsa_2689)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTM9 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Echvi_0101 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTVISSSITRELIDESMDFAQYRALIDQLLLQNKTTGSNHSEAMMDYTRMNVQRMKRWDK
TAKVGKGAVEAVKKIARGQVWLVLTEAWCGDAAQNISYIEKLAAFNENIKIRYILRDENL
AVMDEFLTNGGRSIPKLVALDEATMDVLFTWGPRPQPLQEMMAAFKEDPKGVSAEEFKKT
IHLWYAKDKHQTLEAEFKTLLTQ