Protein Info for Echvi_0092 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Phosphosulfolactate phosphohydrolase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF04029: 2-ph_phosp" amino acids 7 to 228 (222 residues), 259.7 bits, see alignment E=8.5e-82

Best Hits

Swiss-Prot: 31% identical to COMB_CLOK5: Probable 2-phosphosulfolactate phosphatase (comB) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: K05979, 2-phosphosulfolactate phosphatase [EC: 3.1.3.71] (inferred from 51% identity to mtt:Ftrac_1906)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR11 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Echvi_0092 Phosphosulfolactate phosphohydrolase and related enzymes (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKIEVCLSPELIHLHDLHGKIVVVVDIFRATSTMVTGLANKVTSITPVAGLEACRTMKS
KGYIIAGERNGQTAEGFELGNSPLSYLNNGFEGKKIAVTTTNGTLTIEKSKATADEVLIG
AFLNLQATATYLAQQNKDVVIHCAGWKGMFNLEDSLYAGALVSVLDGQFEYDCDGAIAMK
ALFEQHKDDLKGFLSQASHAKRLQNHNIEADIDFCLTMDEFNFIGKLQGEELVKVAL