Protein Info for Echvi_0091 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glycine cleavage system T protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to GCST_FLAPJ: Aminomethyltransferase (gcvT) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 66% identity to dfe:Dfer_4550)

MetaCyc: 42% identical to glycine cleavage system T-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

folate transformations III (E. coli) (8/9 steps found)
glycine biosynthesis II (3/3 steps found)
glycine cleavage (3/3 steps found)
glycine degradation (3/3 steps found)
folate transformations II (plants) (8/11 steps found)
folate transformations I (8/13 steps found)
photorespiration I (4/9 steps found)
photorespiration III (4/9 steps found)
reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)
photorespiration II (4/10 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTM0 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Echvi_0091 glycine cleavage system T protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MENTIKKIALNDKHIELGGKMVPFAGYHMPVRYSSDKEEHNTVRNGVGVFDVSHMGEFMV
TGPHALALIQKVTSNDAAKLVIGQAQYSCLPNETGGIVDDLLVYKMDEEKYLLVVNASNI
EKDWNWINQHNDMGAALENISDEMSLFAVQGPKAVETLQKVTPVNLDEVKFYHFTVGEFA
GKKDVIISGTGYTGAGGFEIYVKNEDALDVWNAIFEAGEAAGIKPIGLGARDTLRMEMGY
CLYGNDIDDTTSPLEAGLGWITKFTKDFINSENLKKQKEEGVTRKLVGFKFKDKGIPRAH
YPIVNEAGKQIGEVTSGTMSPSMNIGIGLGYVEKAYAKPGTEIAITVRNKNLAAVVEKLP
LLKK