Protein Info for Echvi_0090 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Iron-sulfur cluster assembly accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01521: Fe-S_biosyn
  • amino acids 2 to 104 (103 residues), 74.6 bits, E=3.6e-25
• TIGR00049: iron-sulfur cluster assembly accessory protein
  • amino acids 2 to 107 (106 residues), 123.1 bits, E=2.7e-40

Best Hits

Swiss-Prot: 50% identical to ERPA_HAES1: Iron-sulfur cluster insertion protein ErpA (erpA) from Haemophilus somnus (strain 129Pt)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 76% identity to mtt:Ftrac_1573)

MetaCyc: 53% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

See L0FSW3 at UniProt or InterPro

Protein Sequence (108 amino acids)

>Echvi_0090 Iron-sulfur cluster assembly accessory protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIIVSDQAKERIKELRQEEGRKESENIRVSVKGGGCSGLMYDLGFDESITDSDQVFEDKG
VKIVVDKKSLLYLAGTTLEFSDGLNGKGFQFVNPNASRTCGCGESFSI