Protein Info for Echvi_0060 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted nucleoside-diphosphate sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details PF13727: CoA_binding_3" amino acids 65 to 237 (173 residues), 26.2 bits, see alignment E=3.8e-09 PF00106: adh_short" amino acids 280 to 352 (73 residues), 26.5 bits, see alignment E=2.1e-09 PF02719: Polysacc_synt_2" amino acids 282 to 570 (289 residues), 387.5 bits, see alignment E=1.9e-119 PF01370: Epimerase" amino acids 282 to 497 (216 residues), 79 bits, see alignment E=1.9e-25 PF04321: RmlD_sub_bind" amino acids 282 to 456 (175 residues), 53.7 bits, see alignment E=8.9e-18 PF08659: KR" amino acids 282 to 405 (124 residues), 23.2 bits, see alignment E=2.8e-08 PF16363: GDP_Man_Dehyd" amino acids 283 to 406 (124 residues), 58.1 bits, see alignment E=5.6e-19 PF01073: 3Beta_HSD" amino acids 283 to 411 (129 residues), 40.2 bits, see alignment E=1.1e-13 PF07993: NAD_binding_4" amino acids 284 to 420 (137 residues), 31.2 bits, see alignment E=6.2e-11

Best Hits

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSU2 at UniProt or InterPro

Protein Sequence (624 amino acids)

>Echvi_0060 Predicted nucleoside-diphosphate sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKWITRTIDSVILFHSIVLAYFLRFNFEWEVIHQYPVLDSGLLFMFLGVGAMLLTEKEK
WLGSRSRIGNFALVAHTVMVALMLASLACLVTEKLVLKAPFVPISVLVIGALLAYFFMSL
YRLFVKEFYGMYLKKKQPQKHIVIFGAGEAGRLSKTVLGSQVGSNQKIHAFLDDDMQKAG
GSIGGIPVYHGLDRLKTLQRDHAISDLLISIMCISPRRKKEIIEECLQLGIKVSVVPSID
EWVKGGFNVGKIRQIKIEDLLSRPEISLDNPAVFSQISDRVVMVTGAAGSIGSELCRKII
EHKPALLIMVDKAESALYDVEQEFRSGRWKSQIKPILADIRDAKKMDRIFKMYKPAIVYH
AAAYKHVPMMENYPEEAVTSNVLATKNLADLSVLHNVSQFVFVSTDKAVNPTNVMGASKR
IAEIYIQALSRYLDVEKGQVTKFAITRFGNVLGSNGSVIPLFKKQIEQGGPVMVTDPNIS
RYFMTISEACQLILEAGAMSTGNEIFIFDMGEPVKILDLAKKMIQLSDKKIGEDIKIVFT
GLREGEKLHEELLCHSEQLQITHHPKIRVVKMGDMAFSKVNYQIEFFERLLILSSDTEIV
RHIKHIVPEYVSNTSRYHVLDRLN