Protein Info for Echvi_0059 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA polymerase III, subunit gamma and tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 6 to 360 (355 residues), 440.4 bits, see alignment E=2.7e-136 PF13177: DNA_pol3_delta2" amino acids 22 to 180 (159 residues), 156.5 bits, see alignment E=2.8e-49 PF13401: AAA_22" amino acids 39 to 156 (118 residues), 30.1 bits, see alignment E=2.5e-10 PF00004: AAA" amino acids 43 to 174 (132 residues), 48.5 bits, see alignment E=5.5e-16 PF22608: DNAX_ATPase_lid" amino acids 185 to 231 (47 residues), 49.1 bits, see alignment 1.8e-16 PF12169: DNA_pol3_gamma3" amino acids 250 to 364 (115 residues), 24.6 bits, see alignment E=8.4e-09 PF28557: DUF8439" amino acids 468 to 532 (65 residues), 31.3 bits, see alignment E=9.2e-11

Best Hits

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>Echvi_0059 DNA polymerase III, subunit gamma and tau (Echinicola vietnamensis KMM 6221, DSM 17526)
MENFVVSARKYRPSNFKSVVGQQHITTTLKNAIKNNHLAQAFLFCGPRGVGKTTCARILA
KTINCENLSDDFEACNECESCKAFNTNSSFNVHELDAASNNSVDDIRNLVDQVRYAPQKG
SYKIYIIDEVHMLSTQAFNAFLKTLEEPPKYAIFILATTEKHKIIPTILSRCQIFDFNRI
QIKDIAEHLKYIASEEDISYEDEALRLIAAKADGALRDALSIFDLIVTYSAGNKLTYTET
INNLHILDYDYYFKVTDALLAESVSNVLLIFDEILKKGFDGHNFIVGLSEHFRNLMVCKD
AATVELLQVSDSAQERYIEQSAKSNLSFLLSALNICNQCDIHYKGSKNQRLHVELALMKL
AKLPQAISLAAVAREEAKKKRLAKQKSPSASHQEKPSETSTAPKTEVKRTMAIPASLSEV
KSHVKSKEEERKQTPKAEAQKQSNDQKATKSTPFDKGKVGAVLEDVVAHYKQQKRLIEST
LLKQPFEVNETTVKFFLNGELQEHRFAQLRPELVGVFRRKLENDFVEIDFEVKEDAVSEE
AKLYTSSDKLAYLTKKSPALKELQKRFGLETDF