Protein Info for Echvi_0056 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF01596: Methyltransf_3" amino acids 14 to 213 (200 residues), 181.6 bits, see alignment E=3.1e-57 PF01135: PCMT" amino acids 42 to 120 (79 residues), 35 bits, see alignment E=3.3e-12 PF01209: Ubie_methyltran" amino acids 53 to 148 (96 residues), 32.4 bits, see alignment E=1.5e-11 PF13649: Methyltransf_25" amino acids 61 to 155 (95 residues), 29.5 bits, see alignment E=2.5e-10 PF13578: Methyltransf_24" amino acids 62 to 163 (102 residues), 65.1 bits, see alignment E=2.6e-21

Best Hits

KEGG orthology group: None (inferred from 59% identity to fte:Fluta_3112)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FQY0 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Echvi_0056 Predicted O-methyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEFISEDLLQYCQDHTTEEDDLLQRISRDTHAKVLMPRMLSGHLQGKTLELFTKMQRPKT
ILEIGTYTGYSAICMARGLDKDGKIITIDKNDELEEMVREYFAASGLDDQIQYILGNAME
LIPGLNETFDMVFIDADKRNYSNYYHMIIDKVNPGGLILADNVLWSGKVVDDHQGKADKS
TQAILDFNKMVQEDDRVENVLFPIRDGIMMARKR