Protein Info for Echvi_0051 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein S2, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR01011: ribosomal protein uS2" amino acids 4 to 225 (222 residues), 312.7 bits, see alignment E=5.8e-98 PF00318: Ribosomal_S2" amino acids 9 to 224 (216 residues), 302.9 bits, see alignment E=4.9e-95

Best Hits

Swiss-Prot: 77% identical to RS2_CYTH3: 30S ribosomal protein S2 (rpsB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 77% identity to chu:CHU_3037)

MetaCyc: 47% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FQX2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Echvi_0051 ribosomal protein S2, bacterial type (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKIEYKDLLDAGVHFGHLTRKWDPRMAPYIFMEKNGIHIIDLNKTLVCLDEASNALKQI
VRSGKKVMFVATKKQAKDLVAEEAARLKMPYVTERWLGGMMTNFATIRKSLKKMSSIDKM
MKEESYTVLAKKERLMITRQREKLENVLGGISDLTRLPAALFVVDIKREHIAIAEAKKLG
IPVFALVDTNSNPGEADFPIPANDDAFKSISLLVKAVGAAIEEGLSERKKDKEEAKLSEE
EEAKKAADAETKE