Protein Info for Echvi_0039 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein (DUF2154).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 61 to 77 (17 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details PF18917: LiaI-LiaF-like_TM1" amino acids 14 to 52 (39 residues), 28.9 bits, see alignment 9.7e-11 PF22570: LiaF-TM" amino acids 15 to 109 (95 residues), 68.6 bits, see alignment E=7.1e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSS0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Echvi_0039 Predicted membrane protein (DUF2154). (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKTFGGGDGGRTTTGLIVLAVGMFLLVRQLGVSVPGWIFSWPMIFVAIGLITLSKHNFQ
SGFGFFMLLFGGFFLLKNELNIPWELERYLVPGGLIILGLFLLATKNRKAFADFTNWSGG
SSTPPPVGDGPGKGETFVSDKGNAGCSGGFSSVDTDMINSQALFCGIQKRILSKNFKGGK
VSAIFGGTEIDLTQADLSENAVLSVEVAFGGVKLLMPPHWDLKMGVTNIFAGVEDKRMYP
QSTGESNKVLTITGTVLFGGLEIKSY