Protein Info for Echvi_0034 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ATP-binding cassette protein, ChvD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 5 to 558 (554 residues), 946.5 bits, see alignment E=4.6e-289 PF00005: ABC_tran" amino acids 24 to 198 (175 residues), 94.2 bits, see alignment E=2.8e-30 amino acids 347 to 480 (134 residues), 90.7 bits, see alignment E=3.3e-29 PF12848: ABC_tran_Xtn" amino acids 237 to 312 (76 residues), 46.8 bits, see alignment E=6.4e-16

Best Hits

Swiss-Prot: 60% identical to ETTA_MYCTO: Energy-dependent translational throttle protein EttA (ettA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 82% identity to mtt:Ftrac_2855)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSR5 at UniProt or InterPro

Protein Sequence (559 amino acids)

>Echvi_0034 ATP-binding cassette protein, ChvD family (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDEKIIFSMAGVSKIYPPQKKVLKDIYLSFFYGAKIGVLGLNGSGKSSLLKIIAGMDTE
YQGEVAWSSGYSVGMLEQEPELDPEKTVKEVVEEAVAETVGLLKEFEEINEKFMDPAVME
DPDAMNKLIEKQGEVQEKLDAANAWELDVVLDKAMDALRLPPSDAVVENLSGGEKRRVAL
CRLLLQEPDVLLLDEPTNHLDAESVHWLEQHLKQYKGTVIAVTHDRYFLDNVAGWILELD
RGEGIPWKGNYSSWLDQKQKRLAQEEKSESKRQKTLERELEWIKMTPKAKQAKGKARLNA
YEKLVGEDAKERESKLELYIPPGPRLGSKVIEVNGVSKSYGDKLLFEDLTFALPQGGIVG
IIGPNGAGKSTLFKLITGNEKPDAGSFEVGETVQLAYVDQEHDRLDADKTVYQTISEGNE
NIKLGAKEMNARAYVSKFNFSGSDQEKKVGVLSGGERNRVHLALTLKENGNLLLLDEPTN
DLDVNTLRSLEEALENFGGCAVVISHDRWFLDRICTHILAFEGDSQVYWFEGNFTDYEEN
KRKRLGDVDPKRIKYKKLK