Protein Info for Echvi_0020 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: conserved hypothetical protein YmdA/YtgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF12072: RNase_Y_N" amino acids 5 to 204 (200 residues), 134.9 bits, see alignment E=5.3e-43 TIGR03319: ribonuclease Y" amino acids 7 to 519 (513 residues), 663.1 bits, see alignment E=2.6e-203 PF00013: KH_1" amino acids 220 to 266 (47 residues), 31.8 bits, see alignment 1.9e-11 TIGR00277: HDIG domain" amino acids 331 to 407 (77 residues), 72 bits, see alignment E=2.8e-24 PF01966: HD" amino acids 336 to 425 (90 residues), 68.8 bits, see alignment E=1e-22

Best Hits

Swiss-Prot: 73% identical to RNY_CYTH3: Ribonuclease Y (rny) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K06950, uncharacterized protein (inferred from 76% identity to mtt:Ftrac_2866)

Predicted SEED Role

"2',3'-cyclic-nucleotide 2'-phosphodiesterase (EC 3.1.4.16)" in subsystem Purine conversions (EC 3.1.4.16)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FQT8 at UniProt or InterPro

Protein Sequence (519 amino acids)

>Echvi_0020 conserved hypothetical protein YmdA/YtgF (Echinicola vietnamensis KMM 6221, DSM 17526)
MVIYTIIAGIVGLALGAIVVGFFLKKNNQKLEQEAQEKAKSIVREAELTAESLKKDRMLE
AKEKYLKLKADFEEEVNKKKNILITNEGKLKQREQILSKEMEQIKRKEAELDSKKENLSA
QLHAVQVKKDELDRVTNQRIADLEKVALLTKEEARDQLVVMLKDEAHTKASSQIKDILDQ
AKLSATKQAKKIVLDTIQRTATEHAIENCVSIFNIESDDIKGKIIGREGRNIRALESATG
VEIVVDDTPEAIIISGFDPVRREIARLSLHRLVQDGRIHPARIEEVVAKTEKNIEEEIVE
IGERTCIDLGVHGLHPELIRMVGRMRFRSSYGQNLLQHSREVAKLCATMAAEMGLNAKLA
KRAGLLHDIGKVYPEEAELPHAILGMELAKKYKEHPEVCNAIGAHHDEIEMTSMISPIVQ
ASDAISGSRPGARREIMDSYIKRLKDLEDLALSFDGVNKCFAMQAGRELRVLVDAEHVDD
TTAGKLSFDISQKIEKEMQYPGQIKVTVIREMRAVNYAK