Protein Info for Echvi_0018 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane protein and related peptidoglycan-associated (lipo)proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 52 to 70 (19 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 24 to 72 (49 residues), 32.3 bits, see alignment 9.6e-12 PF13488: Gly-zipper_Omp" amino acids 32 to 76 (45 residues), 43.9 bits, see alignment 2.6e-15 PF00691: OmpA" amino acids 104 to 199 (96 residues), 99.2 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 37% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 59% identity to plt:Plut_1338)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FSP8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Echvi_0018 Outer membrane protein and related peptidoglycan-associated (lipo)proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTLKSVLAIVLSATVLFGCANWSNTGKGAAIGAGAGGALGGLIGNNKGNTAAGAVIGAA
VGGAAGAAIGKYMDKQAKEMEEIENAEVERVGEGIQVTFDSGILFGFDSYELTPQAQENV
MEMARILNEYPDTNIMIDGHTDSKGSEEYNQKLSERRASSVANYLKMQGIDSSRLTTVGH
GETAPVASNDTDAGRAENRRVEVAITANEELVEKAENGELDNM