Protein Info for Echvi_0012 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type antimicrobial peptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00005: ABC_tran" amino acids 22 to 163 (142 residues), 111.5 bits, see alignment E=5.1e-36

Best Hits

Swiss-Prot: 37% identical to LOLD_BACTN: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02003, (no description) (inferred from 50% identity to hhy:Halhy_3662)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU82 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Echvi_0012 ABC-type antimicrobial peptide transport system, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MILAKDISFYYEREHAIPIPEITLQQGEELLVLGASGSGKTTVLNILGGLLKPISGVVQI
DNTSIYDLKGAQLDKFRGANIGMVFQKPHILAPLTVKENLQVAQYFSGTSDHGLVERLLK
DLGIFHKAGATVSALSEGEAQRVSIARALVNNPKVVLADEPTASLDDENAEMVISLLKEQ
AKKMRSALIIVTHDHRVKEHVPNQIKMGGDR