Protein Info for Echvi_0007 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cytochrome c, mono- and diheme variants

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00034: Cytochrom_C" amino acids 50 to 133 (84 residues), 39 bits, see alignment E=1.7e-13 PF13442: Cytochrome_CBB3" amino acids 50 to 131 (82 residues), 32.4 bits, see alignment E=9.4e-12

Best Hits

KEGG orthology group: None (inferred from 48% identity to mtt:Ftrac_3377)

Predicted SEED Role

"Copper-containing nitrite reductase (EC 1.7.2.1)" in subsystem Denitrification (EC 1.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU76 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Echvi_0007 Cytochrome c, mono- and diheme variants (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKRNLKKSVTLGLVMSLFLASCGQKDEKDDGLISLNEIEDIKTRQYAIEGQLLYANYCA
NCHQKDGTGLAKLIPPLQDADFMLEDPGKTIRLIKHGIKGEITVNGIRYNQPMPGNPQLT
NLEIAEIATYIYTVFGGNEKRIEVKEVKKYLEEK