Protein Info for Echvi_0005 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details PF03653: UPF0093" amino acids 3 to 146 (144 residues), 139.1 bits, see alignment E=6.7e-45

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 61% identity to mtt:Ftrac_3379)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FQS4 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Echvi_0005 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MGFEYVKALHIIFIVTWFAGLFYVVRLFIYQTEALEKTPEEQKILKPQLDLMAKRLWLGI
TWPSAILTLIFGTWTLTYRLGYLELGFMHAKLAFVVLLYVYHFICHHIYKKLQQGLATWN
STQLRLWNEGATVLLFAIVFLIVLKNLMNMLWGMAGLVGLSILLMLAVKWYKKQREKK