Protein Info for EX28DRAFT_4544 in Enterobacter asburiae PDN3

Annotation: phosphoribosylamine--glycine ligase (EC 6.3.4.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF02844: GARS_N" amino acids 1 to 102 (102 residues), 132.3 bits, see alignment E=2.4e-42 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 424 (424 residues), 621.2 bits, see alignment E=4.2e-191 PF01071: GARS_A" amino acids 103 to 296 (194 residues), 284.4 bits, see alignment E=1.2e-88 PF02655: ATP-grasp_3" amino acids 104 to 291 (188 residues), 25 bits, see alignment E=4.5e-09 PF02786: CPSase_L_D2" amino acids 108 to 246 (139 residues), 25.2 bits, see alignment E=2.8e-09 PF02843: GARS_C" amino acids 332 to 422 (91 residues), 106.8 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 95% identical to PUR2_SALTI: Phosphoribosylamine--glycine ligase (purD) from Salmonella typhi

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 98% identity to enc:ECL_00263)

MetaCyc: 92% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>EX28DRAFT_4544 phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Enterobacter asburiae PDN3)
MKVLVIGNGGREHALAWKAAQSPLVKTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA
QSEKIDLTIVGPEAPLVIGVVDAFRAAGLTIFGPTEGAAQLEGSKAFTKDFLARHNIPTA
EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA
GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT
DEVHQRTMDRVIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM
LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEIE
GAKVFHAGTKLADDDRVLTNGGRVLCATALGHTVAEAQKRAYALMADIHWNGSFSRQDIG
YRAIAREQGE