Protein Info for EX28DRAFT_4532 in Enterobacter asburiae PDN3

Annotation: Uncharacterized enzyme of thiazole biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05690: ThiG
  • amino acids 4 to 247 (244 residues), 366.5 bits, E=6e-114

Best Hits

Swiss-Prot: 93% identical to THIG_ENT38: Thiazole synthase (thiG) from Enterobacter sp. (strain 638)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 97% identity to enc:ECL_00251)

MetaCyc: 91% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Protein Sequence (256 amino acids)

>EX28DRAFT_4532 Uncharacterized enzyme of thiazole biosynthesis (Enterobacter asburiae PDN3)
MLRIADKVFDSHLFTGTGKFASPQLMVDAIRESGSQLVTLALKRVDLRHHSDAILAPLLE
AGVTLLPNTSGAKTAEEAIFAAQLAREALGTRWLKLEIHPDARWLLPDPIETLKAAEKLV
QQGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLETRAMLEIIIEQATVPVVV
DAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVMMARAFRMAVEAGLLARESGPGSRSF
QAQATSPLTGFLEAIS