Protein Info for EX28DRAFT_4514 in Enterobacter asburiae PDN3

Annotation: Flavodoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF12724: Flavodoxin_5" amino acids 4 to 152 (149 residues), 174.9 bits, see alignment E=6.5e-56

Best Hits

Swiss-Prot: 79% identical to HEMG_SALTY: Protoporphyrinogen IX dehydrogenase [menaquinone] (hemG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00230, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 93% identity to enc:ECL_04947)

MetaCyc: 80% identical to protoporphyrinogen oxidase (Escherichia coli K-12 substr. MG1655)
RXN-21483 [EC: 1.3.5.3]; 1.3.5.3 [EC: 1.3.5.3]

Predicted SEED Role

"Protoporphyrinogen IX oxidase, oxygen-independent, HemG (EC 1.3.-.-)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.- or 1.3.3.4 or 1.3.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>EX28DRAFT_4514 Flavodoxin (Enterobacter asburiae PDN3)
MKTLILFSTRDGQTREIAAYLASELKELGIYSDVVNLNRAEQITWQDYDRVVIGASIRYG
HFHPALDRFVKKHTAVLNKLPGAFYSVNLVARKAEKRTPQTNSYTRKFLLSSPWQPDLCA
VFAGALRYPRYRWYDRFMIRLIMKMTGGETDTRKEVVYTDWSQVASFAREIAHLTGDSRH
K