Protein Info for EX28DRAFT_4513 in Enterobacter asburiae PDN3

Annotation: Trk-type K+ transport systems, membrane components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 10 to 32 (23 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 331 to 361 (31 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details amino acids 456 to 480 (25 residues), see Phobius details PF02386: TrkH" amino acids 37 to 477 (441 residues), 343.7 bits, see alignment E=8.1e-107 TIGR00933: potassium uptake protein, TrkH family" amino acids 84 to 466 (383 residues), 430.9 bits, see alignment E=2.5e-133

Best Hits

Swiss-Prot: 98% identical to TRKH_SALTY: Trk system potassium uptake protein TrkH (trkH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to enc:ECL_04948)

MetaCyc: 97% identical to K+ transporter TrkH (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>EX28DRAFT_4513 Trk-type K+ transport systems, membrane components (Enterobacter asburiae PDN3)
MHFRAITRIVGLLVILFSGTMILPGLVALIYRDGAGRAFTQTFFVALAIGSLLWWPNRRQ
KGELKSREGFLIVVLFWTVLGSVGSLPFIFSEQPNLSITDAFFESFSGLTTTGATTLVGL
DSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAE
TAKTLWLIYVLLTVACALALWFAGMPAFDAIGHSFATIAIGGFSTHDASVGYFDSPTINT
IIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQLTLVIICTLVLWFHDVYNS
ALTTLNQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTGGGLKVIRIL
LLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATGV
DDFSAFASVVATLNNLGPGLGVVADNFASMNPVAKWILIANMLFGRLEVFTLLVLFTPTF
WRE