Protein Info for EX28DRAFT_4502 in Enterobacter asburiae PDN3

Annotation: twin arginine-targeting protein translocase TatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01410: twin arginine-targeting protein translocase TatB
  • amino acids 2 to 80 (79 residues), 109.3 bits, E=5.3e-36

Best Hits

Swiss-Prot: 74% identical to TATB_SHIF8: Sec-independent protein translocase protein TatB (tatB) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 91% identity to enc:ECL_04958)

MetaCyc: 74% identical to twin arginine protein translocation system - TatB protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Protein Sequence (180 amino acids)

>EX28DRAFT_4502 twin arginine-targeting protein translocase TatB (Enterobacter asburiae PDN3)
MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVAGWVRALRSLASTVQNELAQELKLQEFQ
ESLKKVEKASMDNLTPELKASMDELREAAESMKRSYSVNDPEKASDEANTIHNPVVKGSE
EQREGVTPASAEHQAAAPEQTPQETEVKKQAQPEEPVAKTAEVKPAASVSEPSPSSSDKA