Protein Info for EX28DRAFT_4500 in Enterobacter asburiae PDN3

Annotation: 2-octaprenylphenol hydroxylase (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 501 to 518 (18 residues), see Phobius details amino acids 524 to 542 (19 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 6 to 446 (441 residues), 617.4 bits, see alignment E=5.8e-190 PF03109: ABC1" amino acids 93 to 344 (252 residues), 261.2 bits, see alignment E=3.6e-82

Best Hits

Swiss-Prot: 95% identical to UBIB_ENT38: Probable protein kinase UbiB (ubiB) from Enterobacter sp. (strain 638)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 95% identity to ent:Ent638_3958)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>EX28DRAFT_4500 2-octaprenylphenol hydroxylase (EC 1.14.13.-) (Enterobacter asburiae PDN3)
MTPGEIRRLYFIIRTFLSYGLDELIPKMRITLPLRIWRRMLFWMPNRHKGQPLGERLRLA
LQELGPVWIKFGQMLSTRRDLFPPLIADELAMLQDRVAPFDGERAKKQIEEAMGNVPVET
WFDDFDIKPLASASIAQVHTARLKENGKEVVIKVIRPDILPVIKADMKLIYRLARWVPRL
LPDGRRLRPLEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYVPEVYSDYCSQNM
MVMERIYGIPVSDVVALEKQGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH
PEDPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE
FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY
PQLDLWKTAKPFLESWIKDQVGIPALVRSLKEKGPFWIEKMPEIPELVYDSLRQSKNLQH
SMDKIARELQSSRVRQGQSRYLFGIGATLLLSGTLLLINRPDWQMMPAWLMAGGVVVWLA
GWRKTR