Protein Info for EX28DRAFT_4495 in Enterobacter asburiae PDN3

Annotation: Dienelactone hydrolase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 41 to 263 (223 residues), 238 bits, E=1.9e-74

Best Hits

Swiss-Prot: 82% identical to DLHH_ECOLI: Putative carboxymethylenebutenolidase (ysgA) from Escherichia coli (strain K12)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 95% identity to enc:ECL_04965)

Predicted SEED Role

"Putative carboxymethylenebutenolidase (EC 3.1.1.45)" (EC 3.1.1.45)

MetaCyc Pathways

• 4-chlorocatechol degradation (2/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Protein Sequence (268 amino acids)

>EX28DRAFT_4495 Dienelactone hydrolase and related enzymes (Enterobacter asburiae PDN3)
MTEKTGFAPAAAPHASTIVSTPEAAITAGETSIPSQGENMPAWHARPKSADGPLPIVIVI
QEIFGVHEHIRDLCRRLALEGYLAVAPELYFRQGDPNDYSDIPTLLSNLVSKVPDAQVLA
DLDHVASWAARNGGDPHRLLVTGFCWGGRISWLYAAHNPQLKAAVAWYGKLVGEKTLNSP
KHPVDIATELNAPVLGLYGGQDTGISIDSVETMRHALRAANAKAEIVVYPDAGHAFNADY
RPSYHAESAKDGWQRMLAWFSQYGGKKA