Protein Info for EX28DRAFT_4487 in Enterobacter asburiae PDN3

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 34 to 622 (589 residues), 910.7 bits, see alignment E=3.9e-278 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 36 to 485 (450 residues), 681.6 bits, see alignment E=5.7e-209 PF00270: DEAD" amino acids 48 to 208 (161 residues), 88.1 bits, see alignment E=1.4e-28 PF00271: Helicase_C" amino acids 241 to 352 (112 residues), 82.1 bits, see alignment E=8.9e-27 PF16124: RecQ_Zn_bind" amino acids 363 to 425 (63 residues), 62.5 bits, see alignment E=1.3e-20 PF09382: RQC" amino acids 427 to 535 (109 residues), 125.6 bits, see alignment E=2.2e-40 PF00570: HRDC" amino acids 554 to 620 (67 residues), 87.5 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 92% identical to RECQ_SALTY: ATP-dependent DNA helicase RecQ (recQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 99% identity to enc:ECL_04973)

MetaCyc: 91% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12 or 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>EX28DRAFT_4487 ATP-dependent DNA helicase RecQ (Enterobacter asburiae PDN3)
MKFLSQALKIAPVSFLAYGVNVAQAEVLNQESLAKQVLHETFGYQQFRPGQETIIETVLE
GRDCLVVMPTGGGKSLCYQVPALVLNGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQ
TREQQQEVMAGCRTGQIRLLYIAPERLMLDNFLDHLAHWNPVLLAVDEAHCISQWGHDFR
PEYAALGQLRQRFPELPFMALTATADDTTRLDIVRLLGLNDPYIQVSSFDRPNIRYMLME
KFKPLDQLLRYVQEQRGKSGIIYCNSRAKVEDTAARLQNRGFSAAAYHAGLENHIRADVQ
EKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLF
YDPADMAWLRRCLEEKPQGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGN
CDICLDPPKQYDGLMDARKALSTIYRVNQRFGMGYVVEVLRGANNQRIRDMGHDKLPVYG
IGKEQSHEHWVSIIRQLIHLGFATQNIAQHSALQLTEAARPVLRGDVELKLAVPRVIALK
PRVMQKSYGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLIEMAEQMPLSASEMLS
VNGVGTRKLERFGKEFMALIRSHADGDDEE