Protein Info for EX28DRAFT_4484 in Enterobacter asburiae PDN3

Annotation: rarD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 261 (254 residues), 368.5 bits, see alignment E=8.9e-115 PF00892: EamA" amino acids 9 to 142 (134 residues), 59.1 bits, see alignment E=3e-20

Best Hits

Swiss-Prot: 93% identical to RARD_SALTY: Protein RarD (rarD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 97% identity to enc:ECL_04976)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>EX28DRAFT_4484 rarD protein (Enterobacter asburiae PDN3)
MDAKQTRQGVLLALAAYFIWGIAPAYFKLIAYVPADEILTHRVIWSFFFMIALMSLSRQW
SGVKTLLQTPKKIFLLALSAVLIGGNWLLFIWAVNNHHMLEASLGYFINPLVNIVLGMIF
LGERFRRMQWVAVILAFCGVLVQLWTFGSLPIIALGLAFSFAFYGLVRKKIAVEAQTGML
FETLWLLPVAAIYLFGIADSATSHMGSNPWSLNLMLMAAGVVTTIPLLCFTGAATRLRLS
TLGFFQYIGPTLMFLLAVVFYGEVPGADKMVTFAFIWVALAIFVADAIYTQRRVRKGL