Protein Info for EX28DRAFT_4483 in Enterobacter asburiae PDN3

Annotation: magnesium Mg(2+) and cobalt Co(2+) transport protein (corA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 255 to 278 (24 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 3 to 316 (314 residues), 376.4 bits, see alignment E=6.3e-117 PF01544: CorA" amino acids 26 to 312 (287 residues), 190.6 bits, see alignment E=2.1e-60

Best Hits

Swiss-Prot: 99% identical to CORA_SALTY: Magnesium transport protein CorA (corA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to enc:ECL_04977)

MetaCyc: 98% identical to Ni2+/Co2+/Mg2+ transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-141; TRANS-RXN-141A; TRANS-RXN-141B

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>EX28DRAFT_4483 magnesium Mg(2+) and cobalt Co(2+) transport protein (corA) (Enterobacter asburiae PDN3)
MLSAFQLENNRLTRLEAEESQPLIDAVWVDLVEPDDDERLRVQSELGQSLATRPELEDIE
ASARFFEDEDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR
SQAMVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIMEGHQGDEYDEALSTLAE
LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL
MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI
LAGLAPYLYFKRRNWL