Protein Info for EX28DRAFT_4473 in Enterobacter asburiae PDN3

Annotation: Uroporphyrinogen-III synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF02602: HEM4" amino acids 14 to 242 (229 residues), 137.4 bits, see alignment E=2.1e-44

Best Hits

Swiss-Prot: 84% identical to HEM4_SALTY: Uroporphyrinogen-III synthase (hemD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 89% identity to ent:Ent638_3988)

MetaCyc: 80% identical to uroporphyrinogen-III synthase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen-III synthase. [EC: 4.2.1.75]

Predicted SEED Role

"Uroporphyrinogen-III synthase (EC 4.2.1.75)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>EX28DRAFT_4473 Uroporphyrinogen-III synthase (Enterobacter asburiae PDN3)
MSILVTRPSPAGEQLVSRLRALGQVAWSFPLIEFSPGRELSALADQMNTLQEGDLLFALS
QHAVEFAHAQLQQQGLAWPTAPRYFAIGRTTALALHTVSSADVRYPLDREISEVLLQLPE
LQTIAGKRALILRGNGGRELLGETLRERGADVTFIECYQRCAKHYDGAEEAMRWHARGIN
TLVVTSGEMLQQLWSLIPLWYRENWLLRCRLLVVSERLANQARELGWQDIRIADNADNDA
LLRALQ