Protein Info for EX28DRAFT_4464 in Enterobacter asburiae PDN3

Annotation: Gamma-aminobutyrate permease and related permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 274 to 299 (26 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details PF00324: AA_permease" amino acids 16 to 428 (413 residues), 374 bits, see alignment E=1.1e-115 PF13520: AA_permease_2" amino acids 20 to 433 (414 residues), 126.7 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 92% identical to YIFK_SALTY: Probable transport protein YifK (yifK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to enc:ECL_04991)

MetaCyc: 93% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Probable transport protein YifK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>EX28DRAFT_4464 Gamma-aminobutyrate permease and related permeases (Enterobacter asburiae PDN3)
MAEKQPELQRGLEARHIELIALGGTIGVGLFMGSASTLKWAGPSVLLAYIIAGLFVFFIM
RSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFP
DMVQWIPALIAVGLVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVVGLGVIFFGFGNGG
HAIGFGNLTENGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKV
LWRILIFYVGAIFVIVTIFPWNEIGTTGSPFVLTFAKIGITAAAGIINFVVLTAALSGCN
SGMYSCGRMLYALSKNNQLPAAMSKVSRAGVPVAGVAVSIAILLIGSCLNYIIPNPQRVF
VYVYSASVLPGMVPWFVILISQLRFRHAHKKAIESHPFRSILFPYANYLTMAFLICVLIG
MYFNEDTRMSLFVGMIFLAAVTAAYKLFGLGRRGTTQKVEE