Protein Info for EX28DRAFT_4436 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00126: HTH_1" amino acids 4 to 62 (59 residues), 78.7 bits, see alignment E=2.5e-26 PF03466: LysR_substrate" amino acids 87 to 267 (181 residues), 48.3 bits, see alignment E=8.7e-17

Best Hits

Swiss-Prot: 84% identical to HDFR_ECO24: HTH-type transcriptional regulator HdfR (hdfR) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_05019)

Predicted SEED Role

"HTH-type transcriptional regulator hdfR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>EX28DRAFT_4436 Transcriptional regulator (Enterobacter asburiae PDN3)
MDTELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLGVNLFTRHRNNIRLTPA
GEKLLPYAETLMNTWQAARKEVAHTSRHNEFSIGASASLWECMLSQWLTRLYHSHGHLQF
EARIAQRQSLVKQLHERQLDLLITTEAPKMDEFSSQIVGQFGLALYASEPSMMKADLTYL
RLEWGPDFQQHETGLIAPDDVPQLTTSSAEIACQQLSLLKGCTWLPVRWADAKAGLHTVL
DSTTLTRPLYAIWLQNSDKQSQIKDLLKINVMD