Protein Info for EX28DRAFT_4428 in Enterobacter asburiae PDN3

Annotation: tRNA (uracil(54)-C(5))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 10 to 369 (360 residues), 606.1 bits, see alignment E=9.6e-187 PF05958: tRNA_U5-meth_tr" amino acids 10 to 369 (360 residues), 620.6 bits, see alignment E=8.3e-191

Best Hits

Swiss-Prot: 92% identical to TRMA_ENT38: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Enterobacter sp. (strain 638)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 96% identity to enc:ECL_05023)

MetaCyc: 91% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

"tRNA (Uracil54-C5-)-methyltransferase (EC 2.1.1.35)" (EC 2.1.1.35)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>EX28DRAFT_4428 tRNA (uracil(54)-C(5))-methyltransferase (Enterobacter asburiae PDN3)
MTPEHLPTEQYDAQLAEKVVRLQSMMTPFNAPVPEVFRSPVSHYRMRAEFRIWHDGDDLY
HIIFDQQTKSRIRVDSFPAASELINQLMTLIMDGVRNNPLLRNKLFQIDYLTTQSNQAII
SLLYHKALNDEWREQAEALRDALRDALRAQNINVHLIGRATKTKIMLDQDYIDERLPVAG
KEMVYRQVENSFTQPNAAMNVQMLEWALKATEGSTGDLLELYCGNGNFSLALARNFDRVL
ATEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVRQFNRLEGIDLKSYQCETI
FVDPPRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLGQTHKVERLALFDQFPYTHH
MECGVLLTAR