Protein Info for EX28DRAFT_4424 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 3 to 61 (59 residues), 78.5 bits, E=3e-26
• PF03466: LysR_substrate
  • amino acids 89 to 292 (204 residues), 189.6 bits, E=4.7e-60

Best Hits

Swiss-Prot: 96% identical to OXYR_ECOLI: Hydrogen peroxide-inducible genes activator (oxyR) from Escherichia coli (strain K12)

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 96% identity to ecd:ECDH10B_4150)

MetaCyc: 96% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Protein Sequence (305 amino acids)

>EX28DRAFT_4424 Transcriptional regulator (Enterobacter asburiae PDN3)
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQA
GLLLVDQARTVLREVKVLKEMASQQGEAMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKL
EMYLHEAQTHQLLAQLDSGKLDCAILALVKESEAFIEVPLFDEPMMLAIYEDHPWANRDR
VPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLL
PALAVPRERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRGSMDGHFDSA
LKQAV