Protein Info for EX28DRAFT_4420 in Enterobacter asburiae PDN3

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 3 to 333 (331 residues), 414.6 bits, see alignment E=1.7e-128 PF01118: Semialdhyde_dh" amino acids 5 to 146 (142 residues), 111.8 bits, see alignment E=4.3e-36 PF22698: Semialdhyde_dhC_1" amino acids 154 to 308 (155 residues), 168.1 bits, see alignment E=2.4e-53 PF02774: Semialdhyde_dhC" amino acids 163 to 311 (149 residues), 73.5 bits, see alignment E=3.7e-24

Best Hits

Swiss-Prot: 89% identical to ARGC_ECOL6: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 97% identity to enc:ECL_05030)

MetaCyc: 89% identical to N-acetylglutamylphosphate reductase (Escherichia coli K-12 substr. MG1655)
N-acetyl-gamma-glutamyl-phosphate reductase. [EC: 1.2.1.38]

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>EX28DRAFT_4420 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) (Enterobacter asburiae PDN3)
MLNTLIVGASGYAGAELVSYVNRHPHMTITALTVSAQSNDAGKLISDLHPQLKGIVDLPL
QPMSDISEFIDGVDVVFLATAHEVSHDLAPQFLAAGCVVFDLSGAFRVNDCAFYEKYYGF
THQHPDLLEKAVYGLAEWSADKLKEADLIAVPGCYPTAAQLSLKPLIDAGLLDLSQWPVI
NATSGVSGAGRKAAISNSFCEVSLQPYGVFNHRHHPEITTHLGAEVIFTPHLGSFPRGIL
ETITCRLKPGVTKEQVNEAFTQAYADKPLVRLYDKGVPALKNVVGLPFCDIGFAVQGEHL
IVVAAEDNLLKGAAAQAMQCANIRFGFLETQALI